leptin receptor mouse

The monoclonal antibody 2F1 reacts with human soluble leptin receptor (sLR) in plasma. Clear. Anti-Leptin Receptor Antibody, Mouse Monoclonal, 10322 ... The 52263 monoclonal antibody specifically binds to the Leptin Receptor (Leptin R/LEPR) which is also known as CD295. It specifically reacts with sLR with a molecular mass of 180kD. Multiple isoforms of CD295 have been detected including a long form with a large cytoplasmic domain capable of signal transduction. Immunogen corresponding to… A probe recognizing all the leptin receptor isoforms was validated on brain sections of adult C57Bl/6J mice using DAB as a chromogen (Supplementary Figures S2A-C). Tested in Flow Cytometry, IHC, ICC, WB applications. Leptin receptor, also known as LEP-R or OB-R, is a type I cytokine receptor, a protein that in humans is encoded by the LEPR gene. Study shows that compared to the other mouse lines, db/db mice with dysfunctional leptin receptors had a significantly longer tail flick latency after saline and buprenorphine. The monoclonal antibody 2F1 reacts with human soluble leptin receptor (sLR) in plasma. Leptin Receptor (LEPR) (soluble) Mouse Monoclonal Antibody ... Leptin receptor messenger RNA was also examined in these tissues by RT-PCR. Leptin Receptor (Lepr) Is a Negative Modulator of Bone ... Boster Bio Anti-Leptin Receptor LEPR Antibody catalog # A00350-4. Midgette JB, Gavigan KE, et al. LEP-R has also been designated as CD295 ( cluster of differentiation 295). Independently reviewed in 6 review(s). It is secreted into the blood circulation by adipose tissues and functions in the central nerve system (i.e., hypothalamus) after crossing the BBB. Receptor for hormone LEP/leptin (Probable) (PubMed:11861497). Mouse Leptin Receptor ELISA Kit PicoKine™ (96 Tests). However, the identity and distribution of these leptin receptor-expressing non-neuronal brain cells remain debated. To learn more comprehensive our antibody product information including immunogen, specificity, and more, you can read all details here. Community curation () Add a publication Feedback. The hypothalamic leptin receptor (Ob-Rb, using mouse nomenclature) is a member of the class I cytokine receptor family. Leptin acts centrally via leptin receptor (LepRb)-expressing neurons to regulate food intake, energy expenditure, and other physiological functions. Leptin Receptor Polyclonal Antibody 4 figures Mouse Rabbit Polyclonal WB IHC (P) 375.00 Cat # PA5-118030 100 µL Invitrogen Leptin Receptor Polyclonal Antibody 3 figures Human Mouse Rat Goat Polyclonal WB IHC IHC (P) 395.00 Cat # PA5-18522 100 µg Bioss Leptin receptor Polyclonal Antibody 5 figures Human Mouse Rat Rabbit Polyclonal View/Edit Mouse. In response to a high-fat diet astrocytic leptin receptor KO mice had attenuated hyperleptinemia and sObR, a lower level of leptin mRNA in subcutaneous fat, and a paradoxical increase in UCP1 mRNA. Storage & Handling. Interestingly, qPCR studies further demonstrated significantly altered expression for Vtn and Pdgfrb in the meninges and hypothalamus of LepRb-deficient mice. Gender-dependent effects of exercise training on serum leptin levels in 33. In this report we show that leptin is produced by normal rat and mouse anterior pituitary cells and by the mouse FS cell line and that OB-Rb is also expressed in these tissues. the crosstalk between leptin and estrogen receptor might be differentiation stage specific in ATDC5 cells. In humans and mice, problems in expression of leptin or leptin receptor are associated with obesity. Lepr is part of the hematopoietic pathway. Lepr expression is present in brain and immune cells. RT-PCR showed that leptin and its receptor isoforms, Ob-Ra, Ob-Rb, and Ob-Re were all expressed in testes from 5- to 60-day-old mice. 6), the importance of Socs3 in leptin action in vivo was unclear. Its location is the cell membrane . The extracel-lular leptin‐binding domain of the leptin receptor possesses strong homology Anti-Leptin Receptor Mouse Monoclonal Antibody (10322-MM05), manufactured by Sino Biological is validated in ELISA. Avoid repeated freeze-thaw cycles. DAB accumulated in leptin receptor-expressing cells of the mouse brain including hypothalamic nuclei, following a distribution that conformed well to that of tdTomato-positive cells. LEPTIN RECEPTOR A. ISOFORMS In 1995, Louis Tartaglia and colleagues identified the leptin receptor gene in the db locus of mouse chromosome 4 (Tartaglia et al., 1995). In the present study we examined leptin and leptin receptor expression in the mouse folliculo-stellate (FS) cell line, which has been shown to be similar to normal folliculo-stellate cells, which express various cytokines (22- 26). IPR041182 Leptin receptor, immunoglobulin-like domain. In basic research, ob/ob mice, db/db mice, Zucker fatty rats and ZDF rats have been extensively used to study the pathogenesis of T2DM, obesity, leptin signaling, and the interactions among the three. >tr|A2AV66|A2AV66_MOUSE Leptin receptor (Fragment) OS=Mus musculus OX=10090 GN=Lepr PE=4 SV=1 MMCQKFYVVLLHWEFLYVIAALNLAYPISP. MeSH terms Animals Blotting, Western OB-Ra has been identified on the brain capillary endothelium and is the major receptor for leptin (Tartaglia et al., 1995 ). On ligand binding, mediates LEP central and peripheral effects through the activation of different signaling pathways such as JAK2/STAT3 and MAPK cascade/FOS (PubMed:10799542, PubMed:25383904, PubMed:11923481, PubMed:11861497). Store at 2 - 8 °C. We have previously identified suppressor of cytokine signaling-3 (Socs3) as a leptin-induced negative regulator of leptin receptor signaling and potential mediator of leptin resistance. Interestingly, few of the CNS locations expressing leptin receptor show STAT3 . Add to basket. LepRb neurons are found throughout the brain, and several distinct populations contribute to energy homeostasis control. We also show that the TSH cell is the principal cell type producing leptin in the rat and mouse pituitary and that leptin inhibits GH 3, but not FS, cell proliferation. However, due to the non-viability of mice with targeted disruption of Socs3 (ref. LEP-R functions as a receptor for the fat cell-specific hormone leptin. LEP-R functions as a receptor for the fat cell-specific hormone leptin. This study reports about bone quality and bone turnover mechanisms in leptin receptor-deficient animals. Several LepRb populations have been identified based on their anatomic location, coexpression of neuropeptides, or other marker genes (3, 8, 10, 22, 36, 61) that helped to clarify their commensurate contribution to full leptin function.In fact, most LepRb populations studied showed a . For short term storage and frequent use, store at 4°C for up to one month. Mice lacking leptin receptor in SF-1 neurons are obese, with increased fat composition and decreased energy expenditure, even when food intake is normal on a standard chow diet 166,167. The 52263 monoclonal antibody specifically binds to the Leptin Receptor (Leptin R/LEPR) which is also known as CD295. CD295 is a type I transmembrane glycoprotein that belongs to the type I Cytokine Receptor family within the Immunoglobulin gene superfamily. Shelf life: one year from despatch. The Mouse Leptin Receptor Is Encoded by the Diabetes (db) Gene. Mouse Genome Database (MGD), Gene Expression Database (GXD), Mouse Models of Human Cancer database (MMHCdb) (formerly Mouse Tumor Biology (MTB), Gene Ontology (GO) Leptin receptor, also known as LEP-R or OB-R, is a type I cytokine receptor, a protein that in humans is encoded by the LEPR gene. Store at 4°C for 6 months, at -20°C for 12 months. Divergent selection on fatness in mice indicates a regulation system independent of the leptin receptor. The leptin receptor (ObR) was first isolated from mouse choroid plexus, and genetic mapping indicated that the diabetes gene (db) encoded ObR [6]. Leptin Receptor Expression in Mouse Intracranial Perivascular Cells Past studies have suggested that non-neuronal brain cells express the leptin receptor. LEP-R has also been designated as CD295 ( cluster of differentiation 295). It specifically reacts with sLR with a molecular mass of 180kD. Custom antibody services and bulk production also available. Validated in WB, IP, IHC and tested in Mouse, Rat, Human. Receptor for hormone LEP/leptin (Probable) (PubMed:11861497). This antibody reacts with Human, Mouse, Rat. After the cloning of the leptin receptor an important remaining question was whether the gene encoding it corresponded to the db locus, as had been predicted by the parabiosis studies of decades ago. Using qPCR studies, we confirmed that the mouse meninges were enriched in Leprb and, to a greater extent, the short isoforms of the leptin receptor. Signal transduction through Lepr regulates fat metabolism in mammals. Mice lacking leptin receptor in SF-1 neurons are obese, with increased fat composition and decreased energy expenditure, even when food intake is normal on a standard chow diet 166,167. The present study was conducted to test the hypothesis that … Leptin receptor (Lepr) belonging to class I cytokine receptor family, binds with leptin, a small non-glycosylated peptide hormone and transduces signal. Leptin receptors belong to the class I cytokine receptor superfamily. Leptin is an appetite regulatory hormone with a molecular mass of 16-kDa. The results provide novel support for the interpretation that acute thermal nociception is associated with altered leptin signaling. The antibody can be used to measure in both free sLR and sLR bound to leptin in plasma. The mRNA for Ob-Ra and Ob-Re, but not Ob-Rb or leptin were identified in both immature (14-day-old) and adult (60-day-old) isolated Leydig cells. The leptin (OB-R) receptor is a member of the cytokine receptor superfamily which plays an important role in mammalian body weight homeostasis and energy balance. The db/db mouse is a model of glucose intolerance, triglyceridemia, hypertension, and obesity (Sullivan et al., 2007), providing researchers with an analogous model to that of metabolic syndrome and type 2 DM in patients. Sensitivity: 5pg/ml. Publication types Research Support, U.S. Gov't, P.H.S. Cite This Product This study investigated the role of leptin receptor (Lepr) signaling in determining the bone mechanosensitivity and also evaluated whether differences in the Lepr signaling may contribute to the differential osteogenic response of the C57BL/6J (B6) and . The neuroendocrine hormone, leptin, works through leptin receptor. Because of the effects of cytokines on pituitary cell growth, we examined the role of leptin in pituitary cell . We compared the bone phenotype of leptin receptor-deficient (db/db) and wild-type mice using micro-computed tomographic (µCT) analysis of the proximal tibias and vertebrae. Leptin receptors are class I cytokine receptors, and six splice variants (ObRa-f) have been identified thus far, with the main signaling carried out by the long isoform (ObRb). We have previously identified suppressor of cytokine signaling-3 (Socs3) as a leptin-induced negative regulator of leptin receptor signaling and potential mediator of leptin resistance. CD295 is a type I transmembrane glycoprotein that belongs to the type I Cytokine Receptor family within the Immunoglobulin gene superfamily. Storage & Handling Store at -20°C for one year. However, due to the non-viability of mice with targeted disruption of Socs3 (ref. Shelf life: one year from despatch. Collectively, our data demonstrate . Collectively, our data indicate that the only non-neuronal cells with significant leptin receptor expression in the adult mouse brain are cells that make up the blood-brain barrier, including, most notably, meningeal perivascular cells. Materials and Methods Animals Data show that leptin receptor deficient (LeprNULL) mice exhibited increased body weight and food intake. Colocalization studies with leptin and pituitary hormones showed leptin expression mainly in TSH cells (24 +/- 2% of TSH cells in the rat pituitary and 31 +/- 1% of TSH . On ligand binding, mediates LEP central and peripheral effects through the activation of different signaling pathways such as JAK2/STAT3 and MAPK cascade/FOS (PubMed:10799542, PubMed:25383904, PubMed:11923481, PubMed:11861497). Nature 1996;379:632-5. The finding of leptin and of the long isoform of leptin receptor in normal rat and mouse pituitaries and in various cell lines implicates an autocrine/paracrine loop in the production and regulation of leptin and leptin receptor in the rodent pituitary.

Candid Customer Service, Montgomery Gator Fanart Hot, Syracuse Basketball Stats 2022, Yugioh Legacy Of The Duelist: Link Evolution Fortune Lady, Vishal Name Style Tattoo, Conservative Jewish Publications,

0 Comment

leptin receptor mouse

leptin receptor mouse